Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

AV45694

Sigma-Aldrich

Anti-HAL antibody produced in rabbit

IgG fraction of antiserum

Sinônimo(s):

Anti-HIS, Anti-HSTD, Anti-Histidine ammonia-lyase

Faça loginpara ver os preços organizacionais e de contrato

Selecione um tamanho

100 μL
R$ 2.711,00

R$ 2.711,00


Previsão de entrega em03 de maio de 2025



Selecione um tamanho

Alterar visualização
100 μL
R$ 2.711,00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

R$ 2.711,00


Previsão de entrega em03 de maio de 2025


fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

IgG fraction of antiserum

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

72 kDa

reatividade de espécies

mouse, human, rat

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... HAL(3034)

Imunogênio

Synthetic peptide directed towards the C terminal region of human HAL

Aplicação

Anti-HAL antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Ações bioquímicas/fisiológicas

Histidine ammonia-lyase (HAL) is a cytosolic enzyme important in histidine catabolism. It catalyzes the nonoxidative deamination of L-histidine to trans-urocanic acid. Defective HAL activity results in accumulation of histidine and histamine in body fluids, a condition termed as hisdinemia.

Sequência

Synthetic peptide located within the following region: EAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTK

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Mathias Baedeker et al.
European journal of biochemistry, 269(6), 1790-1797 (2002-03-16)
Histidine ammonia-lyase (EC 4.3.1.3) catalyzes the nonoxidative elimination of the alpha-amino group of histidine using a 4-methylidene-imidazole-5-one (MIO), which is formed autocatalytically from the internal peptide segment 142Ala-Ser-Gly. The structure of the enzyme inhibited by a reaction with l-cysteine was
M Suchi et al.
Genomics, 29(1), 98-104 (1995-09-01)
Histidase (EC 4.3.1.3) is a cytosolic enzyme that catalyzes the nonoxidative deamination of histidine to urocanic acid. Histidinemia, resulting from reduced histidase activity as reported in Cambridge stock his/his mice and in humans, is the most frequent inborn metabolic error
Yoko Kawai et al.
Human genetics, 116(5), 340-346 (2005-04-05)
Histidinemia (MIM235800) is characterized by elevated histidine in body fluids and decreased urocanic acid in blood and skin and results from histidase (histidine ammonia lyase, EC 4.3.1.3) deficiency. It is the most frequent inborn metabolic error in Japan. Although the

Questions

Reviews

No rating value

Active Filters

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica