AV44910

Anti-MOSPD3 antibody produced in rabbit

IgG fraction of antiserum

• Sinônimo(s): Anti-CDS3, Anti-Motile sperm domain containing 3
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: IgG fraction of antiserum
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 24 kDa
• reatividade de espécies: mouse, human, rat
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_076438
• nº de adesão UniProt: O75425
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• Informações sobre genes: human ... MOSPD3(64598)

Descrição

Imunogênio

Synthetic peptide directed towards the C terminal region of human MOSPD3

Aplicação

Anti-MOSPD3 antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Ações bioquímicas/fisiológicas

Motile sperm domain containing 3 (MOSPD3) is a multi-pass membrane protein containing a major sperm protein (MSP) domain. It has a crucial role in the development of right ventricle. Mutations in the gene encoding for MOSPD3 result in defective cardiac development and neonatal lethality.

Sequência

Synthetic peptide located within the following region: FLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTM

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable