Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos Principais

AV44904

Sigma-Aldrich

Anti-FAM3C antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-Family with sequence similarity 3, member C, Anti-GS3786, Anti-ILEI

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

22 kDa

reatividade de espécies

dog, rat, human, guinea pig, bovine

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_001035109

nº de adesão UniProt

Q92520

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... FAM3C(10447)

Categorias relacionadas

Imunogênio

Synthetic peptide directed towards the C terminal region of human FAM3C

Aplicação

Anti-FAM3C antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Ações bioquímicas/fisiológicas

FAM3C belongs to the family with sequence similarity 3 (FAM3) family and is a secreted cytokine that promotes epithelial to mesenchymal transition, metastasis and tumor formation in the epithelial cells. The activity of FAM3C is essential for formation of retinal lamina and the development of retina.

Sequência

Synthetic peptide located within the following region: DNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
QC14810

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

William S Streitfeld et al.
Cancer biology & therapy, 24(1), 2271638-2271638 (2023-11-06)
The poly(rC) binding protein 1 gene (PCBP1) encodes the heterogeneous nuclear ribonucleoprotein E1 (hnRNPE1), a nucleic acid-binding protein that plays a tumor-suppressive role in the mammary epithelium by regulating phenotypic plasticity and cell fate. Following the loss of PCBP1 function
Tatsuya Katahira et al.
Biochemical and biophysical research communications, 392(3), 301-306 (2010-01-12)
FAM3C is a secreted factor, which is involved in the epithelial to mesenchymal transition. In transcriptome profiling of the mouse retina using microarray, we found that FAM3C is highly expressed in the retina. FAM3C is expressed in the ganglion cell
Thomas Waerner et al.
Cancer cell, 10(3), 227-239 (2006-09-09)
Erk/MAPK and TGFbeta signaling cause epithelial to mesenchymal transition (EMT) and metastasis in mouse mammary epithelial cells (EpH4) transformed with oncogenic Ras (EpRas). In trials to unravel underlying mechanisms, expression profiling for EMT-specific genes identified a secreted interleukin-related protein (ILEI)

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica