AV44249

Anti-PTCH1 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-Patched homolog 1 (Drosophila)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 37 kDa
• reatividade de espécies: dog, bovine, horse, human, mouse, guinea pig, rat
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_001077072
• nº de adesão UniProt: Q6TKP8
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... PTCH1(5727)

Descrição

Descrição geral

Protein patched homolog 1 (PTCH1) is the receptor for secreted sonic hedgehog ligand and belongs to the patched gene family. It is mapped to human chromosome 9q22.32. Ptch1 has 12 transmembrane regions, intracellular middle-loop domain (MLD) and C-terminal domain (CTD) essential for oligomerization.

Imunogênio

Synthetic peptide directed towards the C terminal region of human PTCH1

Aplicação

Anti-PTCH1 antibody produced in rabbit has been used in Flow cytometry/Cell sorting.[1] It is suitable for western blotting at a concentration of 0.25μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Flow cytometry/Cell sorting (1 paper)

Ações bioquímicas/fisiológicas

Mutations in protein patched homolog 1(PTCH1) is implicated in autosomal dominant disorder called the Gorlin syndrome, resulting in developmental abnormalities.

PTCH1 (patched 1; PTC) activates the sonic hedgehog (Hh) signaling pathway that is involved in the development of embryonic structures. PTCH1 is a tumor suppressor that maintains the activity of GLI1, the downstream target of Hh signaling. Mutations and methylation status in PTCH1 gene result in tumorigenesis and malignancy in cancers including colorectal, gastric, melanoma and osteosarcoma.

Sequência

Synthetic peptide located within the following region: TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable