Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos Principais

AV44247

Sigma-Aldrich

Anti-MICA antibody produced in rabbit

IgG fraction of antiserum

Sinônimo(s):

Anti-DAQB-48K1.7, Anti-MGC111087, Anti-MHC class I polypeptide-related sequence A, Anti-PERB11.1

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

IgG fraction of antiserum

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

42 kDa

reatividade de espécies

human

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

Informações sobre genes

human ... MICA(4276)

Imunogênio

Synthetic peptide directed towards the middle region of human MICA

Aplicação

Anti-MICA antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Ações bioquímicas/fisiológicas

MHC Class I polypeptide-related sequences A and B (MICA and MICB) are surface glycoproteins expressed constitutively on the enterocytes. They act as ligands for the natural killer group 2, member D (NKG2D) immunoreceptor activation. MICA binds NKG2D receptor and activates the CD8+T cells. Tissue damage or increased expression of MICA results in auto-antibodies detected in early-onset systemic lupus erythematosus and celiac disease.

Sequência

Synthetic peptide located within the following region: LRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDT

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Antonio López-Vázquez et al.
BMC medicine, 12, 34-34 (2014-02-26)
Overexpression of autologous proteins can lead to the formation of autoantibodies and autoimmune diseases. MHC class I polypeptide-related sequence A (MICA) is highly expressed in the enterocytes of patients with celiac disease, which arises in response to gluten. The aim
Zhenpeng Dai et al.
The Journal of experimental medicine, 206(4), 793-805 (2009-03-18)
The NKG2D receptor stimulates natural killer cell and T cell responses upon engagement of ligands associated with malignancies and certain autoimmune diseases. However, conditions of persistent NKG2D ligand expression can lead to immunosuppression. In cancer patients, tumor expression and shedding
S Bahram et al.
Proceedings of the National Academy of Sciences of the United States of America, 91(14), 6259-6263 (1994-07-05)
Major histocompatibility complex (MHC) class I genes typically encode polymorphic peptide-binding chains which are ubiquitously expressed and mediate the recognition of intracellular antigens by cytotoxic T cells. They constitute diverse gene families in different species and include the numerous so-called
Natasja Nielsen et al.
Immunology, 142(4), 581-593 (2014-03-29)
Rheumatoid arthritis (RA) is an autoimmune disease characterized by chronic inflammation and synovial hyperplasia leading to progressive joint destruction. Fibroblast-like synoviocytes (FLS) are central components of the aggressive, tumour-like synovial structure termed pannus, which invades the joint space and cartilage.

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica