AV43557

Anti-MAOB antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-MGC26382, Anti-Monoamine oxidase B
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 59 kDa
• reatividade de espécies: human, rat, guinea pig, horse, mouse, dog
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_000889
• nº de adesão UniProt: P27338
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... MAOB(4129)

Descrição

Descrição geral

Monoamine oxidase B (MAOB) is a flavin monoamine oxidase that catalyzes oxidative deamination of biogenic and xenobiotic amines. MAOB is found in the mitochondrial outer membrane. Dopamine is a major substrate of MAOB making it a target for the potential treatment of Parkinson′s disease and obesity.

Especificidade

Anti-MAOB polyclonal antibody reacts with human, mouse, pig, bovine, canine, chicken, and rat monoamine oxidase B proteins.

Imunogênio

Synthetic peptide directed towards the C terminal region of human MAOB

Aplicação

Anti-MAOB polyclonal antibody is used to tag monoamine oxidase B for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of monoamine oxidase B in oxidative deamination of important amines such as the neurotransmitter dopamine.

Ações bioquímicas/fisiológicas

MAOB belongs to the flavin monoamine oxidase family. It is a enzyme located in the mitochondrial outer membrane. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous sysytem and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine.The protein encoded by this gene belongs to the flavin monoamine oxidase family. It is a enzyme located in the mitochondrial outer membrane. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous sysytem and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine.

Sequência

Synthetic peptide located within the following region: GKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVPGLLRLIGLTTIFSA

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable