AV41562
Anti-HMGCS2 (AB1) antibody produced in rabbit
IgG fraction of antiserum, lyophilized powder
Sinônimo(s):
Anti-3-Hydroxy-3-methylglutaryl-coenzyme A synthase 2 (mitochondrial)
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Código UNSPSC:
12352203
Produtos recomendados
fonte biológica
rabbit
conjugado
unconjugated
forma do anticorpo
IgG fraction of antiserum
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
Formulário
lyophilized powder
peso molecular
56 kDa
reatividade de espécies
canine, human, horse, rat, pig, rabbit, mouse, chicken, bovine
técnica(s)
western blot: suitable
sequência de imunogênio
FSTASAVPLAKTDTWPKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYT
nº de adesão NCBI
nº de adesão UniProt
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... HMGCS2(3158)
Descrição geral
HMG-coenzyme A synthase 2 (mitochondrial) (HMGCS2) is the mitochondrial form of HMG-CoA synthase, the enzyme that catalyzes the condensation of acetyl-CoA with acetoacetyl-CoA to form HMG-CoA. HMG-CoA synthase 2 regulates and rate-limits ketone body production and mitochondrial fatty acid oxidation within liver cells and some extrahepatic tissues such as the colon.
Especificidade
Anti-HMGCS2 (AB1) polyclonal antibody reacts with bovine, human, mouse, rat, canine, pig, and chicken HMG-coenzyme A synthase 2 proteins.
Imunogênio
synthetic peptide corresponding to a region of human HMGCS2 with an internal ID of P24247
Aplicação
Anti-HMGCS2 (AB1) polyclonal antibody is used to tag the HMG-coenzyme A synthase 2 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of HMG-coenzyme A synthase 2 in ketone body production and mitochondrial fatty acid oxidation within hepatic and other tissues.
forma física
Lyophilized from PBS buffer with 2% sucrose
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
11 - Combustible Solids
Classe de risco de água (WGK)
WGK 1
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Escolha uma das versões mais recentes:
Certificados de análise (COA)
Lot/Batch Number
Não está vendo a versão correta?
Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Maria M Mihaylova et al.
Cell stem cell, 22(5), 769-778 (2018-05-05)
Diet has a profound effect on tissue regeneration in diverse organisms, and low caloric states such as intermittent fasting have beneficial effects on organismal health and age-associated loss of tissue function. The role of adult stem and progenitor cells in
Chia-Wei Cheng et al.
Cell, 178(5), 1115-1131 (2019-08-24)
Little is known about how metabolites couple tissue-specific stem cell function with physiology. Here we show that, in the mammalian small intestine, the expression of Hmgcs2 (3-hydroxy-3-methylglutaryl-CoA synthetase 2), the gene encoding the rate-limiting enzyme in the production of ketone
Ubaldo E Martinez-Outschoorn et al.
Cell cycle (Georgetown, Tex.), 11(21), 3964-3971 (2012-10-23)
We have previously proposed that catabolic fibroblasts generate mitochondrial fuels (such as ketone bodies) to promote the anabolic growth of human cancer cells and their metastasic dissemination. We have termed this new paradigm "two-compartment tumor metabolism." Here, we further tested
Semir Beyaz et al.
Nature, 531(7592), 53-58 (2016-03-05)
Little is known about how pro-obesity diets regulate tissue stem and progenitor cell function. Here we show that high-fat diet (HFD)-induced obesity augments the numbers and function of Lgr5(+) intestinal stem cells of the mammalian intestine. Mechanistically, a HFD induces
Victoire Gouirand et al.
The EMBO journal, 41(9), e110466-e110466 (2022-03-22)
Pancreatic ductal adenocarcinoma (PDA) tumor cells are deprived of oxygen and nutrients and therefore must adapt their metabolism to ensure proliferation. In some physiological states, cells rely on ketone bodies to satisfy their metabolic needs, especially during nutrient stress. Here
Active Filters
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica
