AV41187

Anti-CPEB2 antibody produced in rabbit

IgG fraction of antiserum

• Sinônimo(s): Anti-Cytoplasmic polyadenylation element binding protein 2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• conjugado: unconjugated
• forma do anticorpo: IgG fraction of antiserum
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 37 kDa
• reatividade de espécies: dog, guinea pig, rat, rabbit, bovine, mouse, human, horse
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NP_872291
• nº de adesão UniProt: Q7Z5Q1
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... CPEB2(132864)

Descrição

Descrição geral

Cytoplasmic polyadenylation element binding protein 2 (CPEB2) is an RNA binding protein that regulates cytoplasmic polyadenylation and translation of mRNAs in germ cells and neural cells. CPEB2 is involved in the regulation of the oxygen homoeostasis transcriptional master regulator gene hypoxia-inducible factor-1 (HIF-1).

Especificidade

Anti-CPEB2 polyclonal antibody reacts with bovine, chicken, canine, pig, human, mouse, rat, and zebrafish cytoplasmic polyadenylation element binding protein 2 proteins.

Imunogênio

Synthetic peptide directed towards the middle region of human CPEB2

Aplicação

Anti-CPEB2 polyclonal antibody is used to tag cytoplasmic polyadenylation element binding protein 2 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of CPEB2 in the regulation of mRNA transcription in germ cells and neural cells.

Ações bioquímicas/fisiológicas

CPEB2 is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids.

Sequência

Synthetic peptide located within the following region: DTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVL

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 12 - Non Combustible Liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable