Pular para o conteúdo
Merck
Todas as fotos(3)

Documentos

AV38933

Sigma-Aldrich

Anti-STAT1 (AB3) antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-DKFZp686B04100, Anti-ISGF-3, Anti-STAT91, Anti-Signal transducer and activator of transcription 1, 91 kDa

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(3)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

87 kDa

reatividade de espécies

horse, human, guinea pig, rat, mouse, rabbit, dog

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

NP_644671

nº de adesão UniProt

P42224

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... STAT1(6772)

Imunogênio

Synthetic peptide directed towards the N terminal region of human STAT1

Ações bioquímicas/fisiológicas

Signal transducers and activators of transcription (STAT) are a group of proteins that mediate a wide range of cellular functions by activation of gene transcription. STAT1 is activated by IFG-γ, IFN-α, PDGF and IL-6. It acts with important signaling pathways mediated by JAK and MAPK to mediate inflammation and cell viability in response to pathogens and cell stimuli. STAT1 expression levels have prognostic value in in specific types of breast cancer.

Sequência

Synthetic peptide located within the following region: MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDV

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Antonis E Koromilas et al.
JAK-STAT, 2(2), e23353-e23353 (2013-09-24)
The anti-tumor function of STAT1 through its capacity to control the immune system and promote tumor immune surveillance has been well understood. However, little is known about cell autonomous (i.e., tumor cell-specific) functions of STAT1 in tumor formation. Recent studies
Nancy Au-Yeung et al.
JAK-STAT, 2(3), e23931-e23931 (2013-09-27)
STAT1 and STAT2 proteins are key mediators of type I and type III interferon (IFN) signaling, and are essential components of the cellular antiviral response and adaptive immunity. They associate with IFN regulatory factor 9 (IRF9) to form a heterotrimeric
Shihao Chen et al.
Frontiers in microbiology, 11, 603131-603131 (2020-12-29)
Avian leukosis virus subgroup J (ALV-J), an oncogenic retrovirus, is known to cause immunosuppression and various types of cancer in chickens. Recent reports have shown that epigenetic changes in DNA and chromatin are widely implicated in the life cycle of
Isabella Rauch et al.
JAK-STAT, 2(1), e23820-e23820 (2013-09-24)
Interferons (IFN) are subdivided into type I IFN (IFN-I, here synonymous with IFN-α/β), type II (IFN-γ) and type III IFN (IFN-III/IFN-λ) that reprogram nuclear gene expression through STATs 1 and 2 by forming STAT1 dimers (mainly IFN-γ) or the ISGF3
Yao-Tsung Yeh et al.
International journal of cancer, 118(12), 2943-2947 (2006-01-21)
Although it is known that STAT3 transcriptional activity is modulated by phosphorylation at serine residue 727, the role of STAT3 serine phosphorylation in breast cancer remains mostly unexplored. In this study, we examined the expression patterns of serine residue 727-phosphorylated
Exibir todos os documentos relacionados

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica