AV38090

Anti-EGR4 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-Early growth response 4
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 51 kDa
• reatividade de espécies: rat, horse, mouse, dog, rabbit, bovine, human, guinea pig
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NP_001956
• nº de adesão UniProt: Q05215
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... EGR4(1961)

Descrição

Descrição geral

Early growth response (Egr) proteins are transcriptional regulators (Egr1-4) of gene expression involved in the growth and differentiation of many cells. Early growth response 4 (EGR4, NGFI-C, pAT133), a member of the Egr family of zinc-finger transcription factors, regulates early stage meiosis and functions as a master gene transcription regulator of processes such as spermatogenesis and male fertility. Egr4 is an important component in the mechanism for trophic factor-mediated upregulation of K-Cl cotransporter (KCC2) in immature neurons.

Especificidade

Anti-EGR4 polyclonal antibody reacts with human, mouse, rat, canine, zebrafish, bovine, and chicken early growth response 4 proteins.

Imunogênio

Synthetic peptide directed towards the C terminal region of human EGR4

Aplicação

Anti-EGR4 polyclonal antibody is used to tag early growth response 4 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of early growth response 4 protein in spermatogenesis and male fertility.

Ações bioquímicas/fisiológicas

The nerve growth factor-induced clone C (NGFI-C/EGR4) gene is a zinc-finger transcription factor that is rapidly induced by nerve growth factor in rat pheochromocytoma PC12 cells and by seizure in brain. NGFI-C/EGR4 is closely related to the previously described early response genes, nerve growth factor-induced clone A (NGFI-A or EGR1), EGR2, and EGR3. These four early response (immediate early) proteins all contain very similar zinc-finger DNA binding domains and five highly homologous subdomains. EGR-4 functionally cooperate with NFAT proteins and induce expression of IL-2 and TNFalpha. Early growth response proteins (EGR) and nuclear factors of activated T cells (NFAT) form heterodimers and regulate proinflammatory cytokine gene expression.

Sequência

Synthetic peptide located within the following region: RSDHLTSHVRTHTGEKPFACDVCGRRFARSDEKKRHSKVHLKQKARAEER

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable