AV35503

Anti-KCNRG (AB1) antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-DLTET, Anti-Potassium channel Regulator
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 26 kDa
• reatividade de espécies: human
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NP_775876
• nº de adesão UniProt: Q8N5I3
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... KCNRG(283518)

Descrição

Descrição geral

The previously assigned protein identifier Q0P6D0 has been merged into Q8N5I3. Full details can be found on the UniProt database.

Imunogênio

Synthetic peptide directed towards the N terminal region of human KCNRG

Ações bioquímicas/fisiológicas

KCNRG is a soluble protein with characteristics suggesting it forms heterotetramers with voltage-gated K(+) channels and inhibits their function.KCNRG is a soluble protein with characteristics suggesting it forms heterotetramers with voltage-gated K(+) channels (see MIM 176260) and inhibits their function (Ivanov et al., 2003 [PubMed 12650944]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-818 AY169388.1 1-818 819-916 AY190922.1 599-696 917-1625 AY169388.1 819-1527

Sequência

Synthetic peptide located within the following region: TEFSDYLRLQREALFYELRSLVDLLNPYLLQPRPALVEVHFLSRNTQAFF

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 2
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable