AV34357

Anti-C14ORF101 antibody produced in rabbit

affinity isolated antibody

• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 79 kDa
• reatividade de espécies: human
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NP_060269
• nº de adesão UniProt: Q9NX78
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... C14ORF101(54916)

Descrição

Descrição geral

C14ORF101 (TMEM260) is a transmembrane protein.
Rabbit Anti-C14ORF101 antibody recognizes human, mouse, rat, and bovine C14ORF101.

Imunogênio

Synthetic peptide directed towards the N terminal region of human C14ORF101

Aplicação

Rabbit Anti-C14ORF101 antibody can be used for western blot applications at a concentration of 0.125 μg/ml.

Ações bioquímicas/fisiológicas

C14orf101 is a protein predicted based on an ORF found in chromosome 14.

Sequência

Synthetic peptide located within the following region: WGDQTTLQGFLTHFLREEYGTFSLAKSEIGSSMSEILLSQVTNMRTELSF

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable