AV34006

Anti-BHLHB2 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-Basic helix-loop-helix domain containing, class B, 2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 45 kDa
• reatividade de espécies: mouse, guinea pig, rat, human, horse
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_003661
• nº de adesão UniProt: O14503
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• Informações sobre genes: human ... BHLHB2(8553)

Descrição

Imunogênio

Synthetic peptide directed towards the middle region of human BHLHB2

Ações bioquímicas/fisiológicas

BHLHB2 is a basic helix-loop-helix protein expressed in various tissues. Expression in the chondrocytes is responsive to the addition of Bt2cAMP. Differentiated embryo chondrocyte expressed gene 1 is believed to be involved in the control of cell differentiation.DEC1 encodes a basic helix-loop-helix protein expressed in various tissues. Expression in the chondrocytes is responsive to the addition of Bt2cAMP. Differentiated embryo chondrocyte expressed gene 1 is believed to be involved in the control of cell differentiation.DEC1 encodes a basic helix-loop-helix protein expressed in various tissues. Expression in the chondrocytes is responsive to the addition of Bt2cAMP. Differentiated embryo chondrocyte expressed gene 1 is believed to be involved in the control of cell differentiation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sequência

Synthetic peptide located within the following region: SEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDE

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable