Pular para o conteúdo
Merck
Todas as fotos(3)

Documentos Principais

AV32797

Sigma-Aldrich

Anti-SCD antibody produced in rabbit

IgG fraction of antiserum

Sinônimo(s):

Anti-Stearoyl-CoA desaturase (δ-9-desaturase)

Faça loginpara ver os preços organizacionais e de contrato

Selecione um tamanho

100 μL
R$ 2.017,00

R$ 2.017,00


Previsão de entrega em22 de abril de 2025



Selecione um tamanho

Alterar visualização
100 μL
R$ 2.017,00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

R$ 2.017,00


Previsão de entrega em22 de abril de 2025


fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

IgG fraction of antiserum

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

41 kDa

reatividade de espécies

human

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... SCD(6319)

Descrição geral

Rabbit polyclonal anti-SCD antibody reacts with human and bovine stearoyl-CoA desaturases.
Stearoyl-CoA desaturase (SCD) is a rate-limiting enzyme that catalyses the conversion of saturated fatty acids to monounsaturated fatty acids (MUFA). SCD functions as a homeostatic check-point between glucose and fatty acid metabolism. It is a key enzyme target in the search for potential drugs to manage obesity.

Imunogênio

Synthetic peptide directed towards the middle region of human SCD

Aplicação

Rabbit Anti-SCD antibody can be used for western blot applications at a concentration of 1.0 μg/ml. It can also be used for IHC at 4-8 μg/ml, using paraffin-embedded tissues.
Rabbit polyclonal anti-SCD antibody is used to tag stearoyl-CoA desaturase for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of stearoyl-CoA desaturases in the homeostasis of fatty acid metabolism at the level of monounsaturation.

Ações bioquímicas/fisiológicas

Stearoyl-CoA desaturase ( fatty acid desaturase, SCD) is expressed at high levels in several human tissues and is required for the biosynthesis of oleate (18:1) and palmitoleate (16:1). These monounsaturated fatty acids are the major components of phospholipids, triglycerides, wax esters, and cholesterol esters.

Sequência

Synthetic peptide located within the following region: HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Ana S H Costa et al.
PloS one, 13(4), e0193875-e0193875 (2018-04-04)
Despite the recent advances in transcriptomics, gene expression studies addressing cattle´s skeletal muscle adaptations in response to compensatory growth are warranted, particularly regarding lipid metabolism due to its impact in meat sensory and nutritional traits. In the present study, in

Questions

Reviews

No rating value

Active Filters

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica