AV32769

Anti-CREB3 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-cAMP responsive element binding protein 3
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 41 kDa
• reatividade de espécies: dog, human, pig
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NP_006359
• nº de adesão UniProt: Q5TCV1
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• Informações sobre genes: human ... CREB3(10488)

Descrição

Imunogênio

Synthetic peptide directed towards the C terminal region of human CREB3

Ações bioquímicas/fisiológicas

CREB3 is a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element, an octameric palindrome. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. An additional transcript variant has been identified, but its biological validity has not been determined.

Sequência

Synthetic peptide located within the following region: YSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLD

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable