AV32639

Anti-HOXB9 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-HGNC:5120, Anti-HOX-2.5, Anti-HOX2, Anti-HOX2E, Anti-Homeobox protein Hox-B9
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 28 kDa
• reatividade de espécies: rabbit, bovine, horse, pig, human
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_076922
• nº de adesão UniProt: P17482
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... HOXB9(3219)

Descrição

Descrição geral

HOXB9 is a homeobox transcription factor that regulates cell growth and differentiation. HOXB9 is expressed throughout early bovine embryogenesis and has been implicated in thyroid cancer.
Rabbit Anti-HOXB9 antibody recognizes human, mouse, rat, bovine, and canine HOXB9.

Imunogênio

Synthetic peptide directed towards the N terminal region of human HOXB9

Aplicação

Rabbit Anti-HOXB9 antibody has been used to detect Hoxb9 in bovine in embryos using whole-mount immunofluorescence and western blot techniques. The antibody has also been used at a dilution of 1:50 for immunohistochemical analysis in papillary thyroid carcinomas.

Ações bioquímicas/fisiológicas

HOXB9 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. HOXB9 is one of several homeobox HOXB genes located in a cluster on chromosome 17. The exact role of this gene has yet to be determined.

Sequência

Synthetic peptide located within the following region: SPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAV

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable