Pular para o conteúdo
Merck
Todas as fotos(3)

Documentos Principais

AV32303

Sigma-Aldrich

Anti-FOXL1 antibody produced in rabbit

IgG fraction of antiserum

Sinônimo(s):

Anti-Forkhead box L1

Faça loginpara ver os preços organizacionais e de contrato

Selecione um tamanho

100 μL
R$ 2.017,00

R$ 2.017,00


Check Cart for Availability


Selecione um tamanho

Alterar visualização
100 μL
R$ 2.017,00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

R$ 2.017,00


Check Cart for Availability

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

IgG fraction of antiserum

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

36 kDa

reatividade de espécies

bovine, horse, human, pig, dog

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... FOXL1(2300)

Descrição geral

The Forkhead Box L1 (FoxL1) is a transcription factor that modulates epithelial growth and gastrointestinal development. This transcription factor has been implicated in pancreatic and gastrointestinal carcinogenesis and can also function as prognostic biomarker for clear cell renal cell carcinoma. Studies in mce have also revealed that FoxL1 can function as a biological marker of the hepatic progenitor cells.
Rabbit Anti-FOXL1 antibody recognizes canine, human, and mouse FOXL1.

Imunogênio

Synthetic peptide directed towards the N terminal region of human FOXL1

Aplicação

Rabbit Anti-FOXL1 antibody can be used for western blot (2.5μg/ml) and IHC (4-8μg/ml) assays.

Ações bioquímicas/fisiológicas

FOXL1 is a member of the forkhead family. The forkhead domain is a monomeric DNA binding motif that defines a rapidly growing family of eukaryotic transcriptional regulators. Genetic and biochemical data suggest a central role in embryonic development for forkhead proteins.

Sequência

Synthetic peptide located within the following region: HLFDPRLPALAASPMLYLYGPERPGLPLAFAPAAALAASGRAETPQKPPY

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Feng-Qiang Yang et al.
International journal of clinical and experimental pathology, 7(1), 110-122 (2014-01-16)
The Forkhead Box L1 (Foxl1) transcription factor regulates epithelial proliferation and development of gastrointestinal tract, and has been implicated in gastrointestinal and pancreatic tumorigenesis. However, the role of Foxl1 in renal cancer development and progression remains to be elucidated. The
Sara D Sackett et al.
Hepatology (Baltimore, Md.), 49(3), 920-929 (2008-12-24)
The liver contains a population of small bipotential facultative progenitor cells that reconstitute liver function when mature hepatocytes or cholangiocytes are unable to proliferate. Mesenchymal markers, including members of the forkhead transcription factor gene family, have been detected in hepatic

Questions

Reviews

No rating value

Active Filters

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica