AV31476

Anti-CDX2 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-Caudal type homeobox transcription factor 2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 34 kDa
• reatividade de espécies: human, bovine, rabbit, mouse, rat, guinea pig, dog
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NP_001256
• nº de adesão UniProt: Q99626
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... CDX2(1045)

Descrição

Descrição geral

Cdx2 is a homeobox gene that regulates trophectoderm differentiation and cell fate decisions in mouse blastocysts. CDX2 expression has also been linked to intestinal metaplasia and gastric carcinogenesis.
Rabbit Anti-CDX2 antibody recognizes canine, chicken, human, mouse, rat, and pig CDX2.

Imunogênio

Synthetic peptide directed towards the middle region of human CDX2

Aplicação

Rabbit Anti-CDX2 antibody can be used for western blot assays at a concentration of 0.5μg/ml.

Ações bioquímicas/fisiológicas

CDX2 encodes a protein that plays an important role in gallbladder carcinogenesis with intestinal differentiation. Cdx2 is a highly sensitive marker for Barrett′s esophagus.

Sequência

Synthetic peptide located within the following region: QRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRY

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable