AV31200

Anti-ISGF3G antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-IRF-9, Anti-ISGF3, Anti-ISGF3G, Anti-p48
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 44 kDa
• reatividade de espécies: rabbit, human, rat, bovine, mouse, guinea pig, dog, horse
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_006075
• nº de adesão UniProt: Q00978
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• Informações sobre genes: human ... ISGF3G(10379)

Descrição

Descrição geral

Interferon regulatory factor 9 (ISGF3G, IRF-9, p48) is a DNA-binding component of the heterotrimeric transcription factor ISGF3 which is activated by interferon-α and β (type I IFNs). The other two components of ISGF3 are STAT1 and STAT2. ISGF3 gamma or complexes containing ISGF3 gamma are involved in IRF-1-independent pathways mediating IFN gene regulation. ISGF3 plays a primary role in the transmission of a signal from the cell surface to the nucleus via regulatory factors p84/91 and p113.

Rabbit polyclonal anti-ISGF3G antibody reacts with pig, bovine, human, mouse, rat, and zebrafish interferon regulatory factor 9/ISGF3 gamma proteins.

Imunogênio

Synthetic peptide directed towards the N terminal region of human ISGF3G

Aplicação

Rabbit Anti-ISGF3G antibody can be used for western blotting applications at 2.5μg/ml.

Rabbit polyclonal anti-ISGF3G antibody is used to tag interferon regulatory factor 9/ISGF3 gamma for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of interferon regulatory factor 9/ISGF3 gamma in the mediation of interferon-α and β (type I IFNs) signaling.

Ações bioquímicas/fisiológicas

ISGF3G functions to recruit RNA polymerase II to the promoter of interferon-stimulated genes and requires histone deacetylases. Defects in ISGF3 can cause resistance to IFN-.(2a) treatment.

Sequência

Synthetic peptide located within the following region: PWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNK

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable