Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos

AV13019

Sigma-Aldrich

Anti-CHRNA9 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-Cholinergic receptor, nicotinic, α-9 (muscle)

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

55 kDa

reatividade de espécies

guinea pig, horse, human, bovine, dog, rabbit

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_060051

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

Informações sobre genes

human ... CHRNA9(55584)

Imunogênio

Synthetic peptide directed towards the N terminal region of human CHRNA9

Aplicação

Anti-CHRNA9 antibody produced in rabbit is suitable for western blotting at a concentration of 0.0625 μg/ml.

Ações bioquímicas/fisiológicas

CHRNA9 is a transmembrane oligomeric ligand-gated nicotinic receptor that induces ion channel opening for the movement of positive ions when it is activated by cholinergic binding. Nicotinic acetylcholine receptors mediate presynaptic, postsynaptic and extrasynaptic signaling. The expression of CHRNA9 receptor has been observed to be elevated in human breast epithelial cells during tumorigenesis. CHRNA9 has been implicated in stress-induced functional plasticity of rat adrenal medulla.

Sequência

Synthetic peptide located within the following region: MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVE

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Claude Colomer et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 30(19), 6732-6742 (2010-05-14)
An increase in circulating adrenal catecholamine levels constitutes one of the mechanisms whereby organisms cope with stress. Accordingly, stimulus-secretion coupling within the stressed adrenal medullary tissue undergoes persistent remodeling. In particular, cholinergic synaptic neurotransmission between splanchnic nerve terminals and chromaffin
Chia-Hwa Lee et al.
Journal of the National Cancer Institute, 102(17), 1322-1335 (2010-08-25)
Large epidemiological cohort studies in the United States have indicated that active and passive smoking are associated with increased breast cancer risk. However, there was no direct evidence of an effect of tobacco carcinogens on the cellular molecules involved in
Inmaculada Posadas et al.
Current neuropharmacology, 11(3), 298-314 (2013-11-02)
Many studies have focused on expanding our knowledge of the structure and diversity of peripheral and central nicotinic receptors. Nicotinic acetylcholine receptors (nAChRs) are members of the Cys-loop superfamily of pentameric ligand-gated ion channels, which include GABA (A and C)

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica