AV100960

Anti-PC4 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: IgG fraction of antiserum
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 14 kDa
• reatividade de espécies: rat, bovine, dog, mouse, human
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_006704
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... PC4(10923)

Descrição

Imunogênio

Synthetic peptide directed towards the middle region of human PC4

Aplicação

Anti-PC4 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5-1 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.

Ações bioquímicas/fisiológicas

PC4 is a chromatin associated protein that contains a non-specific DNA-binding domain. It is involved in processes of replication, transcription and DNA repair. It exhibits a complex role with negative and positive effects on gene expression by influencing transcription initiation, elongation, termination and reinitiation processes. It stimulates ligase-mediated DNA end joining and activates double-strand break (DSB) repair activity. PC4 is a positive activator of p53 and is overexpressed during genotoxic insult to the cells.

Sequência

Synthetic peptide located within the following region: NMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWS

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable