AV100932
Anti-HOXA10 (AB2) antibody produced in rabbit
IgG fraction of antiserum
Sinônimo(s):
Anti-Homeobox A10
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
fonte biológica
rabbit
Nível de qualidade
conjugado
unconjugated
forma do anticorpo
IgG fraction of antiserum
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
Formulário
buffered aqueous solution
peso molecular
41 kDa
reatividade de espécies
dog, bovine, pig, rabbit, human
concentração
0.5 mg - 1 mg/mL
técnica(s)
western blot: suitable
nº de adesão NCBI
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... HOXA10(3206)
Descrição geral
Homeobox A10 (HOXA10) is a homeodomain transcription factor involved in definitive hematopoiesis and implicated in the pathogenesis of acute myeloid leukemia (AML). HOXA10 facilitates myeloid progenitor expansion/proliferation while impeding myeloid differentiation. Sustained HoxA10expression during differentiation has been described in poor prognosis human acute myeloid leukemia (AML).
Rabbit polyclonal anti-HOXA10 antibody reacts with rabbit, pig, canine, mouse, bovine, human, and rat homeobox A10 transcription factors.
Imunogênio
Synthetic peptide directed towards the N terminal region of human HOXA10
Aplicação
Rabbit polyclonal anti-HOXA10 antibody is used to tag homeobox A10 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of homeobox A10 in hematopoiesis involving the expansion of myeloid progenitor populations and the development of acute myeloid leukemia (AML). Anti-HOXA10 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
Ações bioquímicas/fisiológicas
HOXA10 is an important regulator of embryogenesis and lineage determination of hematopoietic progenitor cells. In primates, HOXA10 maintains uterine homeosis to regulate receptivity and implantation by synchronizing the maternal and embryonic signaling on the endometrial cells.
Sequência
Synthetic peptide located within the following region: SLGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRL
forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 3
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Escolha uma das versões mais recentes:
Certificados de análise (COA)
Lot/Batch Number
Não está vendo a versão correta?
Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Fei Li et al.
Molecular medicine reports, 11(1), 509-514 (2014-10-18)
The present study aimed to investigate whether gonadotropin-releasing hormone analogues (GnRH-as), including GnRH agonists and antagonists, affect endometrial homeobox (Hox) a10 DNA methylation during the implantation window in mice. GnRH analogue mouse models were used and were treated with either
Tom Taghon et al.
Blood, 99(4), 1197-1204 (2002-02-07)
Homeobox genes are well known for their crucial role during embryogenesis but have also been found to be critically involved in normal and leukemic hematopoiesis. Because most previous studies focused on the role of aberrant HOX gene expression in leukemogenesis
G B Godbole et al.
Reproduction (Cambridge, England), 134(3), 513-523 (2007-08-22)
Homeobox A10 (HOXA10), a member of abdominal B subclass of homeobox genes, is responsible for uterine homeosis during development. Intriguingly, in the adult murine uterus, HOXA10 has been demonstrated to play important roles in receptivity, embryo implantation, and decidualization. However
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica