Even-skipped homeobox 1 (EVX1) is a homeobox transcription factor involved in embryonic stem cell differentiation and embryogenesis. EVX1 has been shown to control ESC differentiation at least in part by repressing GOOSECOID expression.
Rabbit polyclonal anti-EVX1 antibody reacts with chicken, human, mouse, rat, canine, bovine, and rabbit Even-skipped homeobox 1 transcription factors.
Imunogênio
The immunogen for anti-EVX1 antibody: synthetic peptide derected towards the N terminal of human EVX1
Aplicação
Rabbit polyclonal anti-EVX1 antibody is used to tag Even-skipped homeobox 1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of Even-skipped homeobox 1 in the regulation of embryonic stem cell (ESC) differentiation and embryogenesis, especially within the region of the primitive streak. The antibody is suitable for western blotting at a concentration of 1-2 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Ações bioquímicas/fisiológicas
EVX1 appears just prior to grastrulation in the region of ectoderm containing cells destined to be found in the primitive streak, where it may be involved in dorsoventral specification of mesodermal cell fate. EVX1 is believed to be a postmitotic determinant of V0 interneuron identity. The expression of genes regulated by EVX1 is crucial for the development of zebrafish fin dermoskeleton.
Sequência
Synthetic peptide located within the following region: AGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQPSSSDTESDFYEEI
forma física
Lyophilized from PBS buffer with 2% sucrose
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Developmental dynamics : an official publication of the American Association of Anatomists, 240(5), 1240-1248 (2011-04-22)
The transcription factor Evx1 is expressed in the joints between individual lepidotrichia (bony ray) segments and at the distal tips of the lepidotrichia in developing zebrafish fins. It is also expressed in the apical growth zone in regenerating fins. However
Interneurons in the ventral spinal cord are essential for coordinated locomotion in vertebrates. During embryogenesis, the V0 and V1 classes of ventral interneurons are defined by expression of the homeodomain transcription factors Evx1/2 and En1, respectively. In this study, we
Questions
Reviews
★★★★★ No rating value
Active Filters
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
