Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos Principais

AV07030

Sigma-Aldrich

Anti-CXCR6 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-BONZO, Anti-CD186, Anti-Chemokine (C-X-C motif) receptor 6, Anti-STRL33, Anti-TYMSTR

Faça loginpara ver os preços organizacionais e de contrato

Selecione um tamanho

100 μL
R$ 3.345,00

R$ 3.345,00

Previsão de entrega em06 de abril de 2025

Todas as fotos(1)

Selecione um tamanho

Alterar visualização
100 μL
R$ 3.345,00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.43

R$ 3.345,00

Previsão de entrega em06 de abril de 2025

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

39 kDa

reatividade de espécies

human

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_006555

nº de adesão UniProt

O00574

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

Informações sobre genes

human ... CXCR6(10663)

Imunogênio

Synthetic peptide directed towards the N terminal region of human CXCR6

Aplicação

Anti- CXCR6 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Ações bioquímicas/fisiológicas

CXCR6, a chemokine receptor binds CXCL16 and promotes invasion and tumor growth.[1][2] It is expressed by activated T cells in inflammatory diseases such as Crohn′s disease[1] and is associated with poor prognosis of hepatocellular carcinoma[2] and bladder cancer.[3]

Sequência

Synthetic peptide located within the following region: AEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSL

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
QC0513

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Jun Taik Lee et al.
Oncology letters, 5(1), 229-235 (2012-12-21)
The interactions between chemokines and their receptors are closely involved in the progression and metastasis of cancer. We hypothesized that the CXCL16-CXCR6 ligand-receptor system plays an important role in bladder cancer progression. To evaluate this hypothesis, the expression levels of
Qiang Gao et al.
Cancer research, 72(14), 3546-3556 (2012-06-20)
CXC chemokines and their cognate receptors have been implicated widely in cancer pathogenesis. In this study, we report a critical causal relationship between CXCR6 expression and tumorigenesis in the setting of human hepatocellular carcinoma (HCC). Among the CXC chemokine receptors
Yasushi Mandai et al.
PloS one, 8(6), e65488-e65488 (2013-07-11)
CD4(+) T cells play a central role in the development of inflammatory bowel disease (IBD) via high-level production of effector cytokines such as IFN-γ and TNF-α. To better characterize the colitogenic CD4(+) T cells, we examined their expression of CXCR6

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica