AV03047
Anti-CDKN2B antibody produced in rabbit
affinity isolated antibody
Sinônimo(s):
Anti-Cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
fonte biológica
rabbit
conjugado
unconjugated
forma do anticorpo
affinity isolated antibody
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
forma
buffered aqueous solution
peso molecular
15 kDa
reatividade de espécies
human, pig
concentração
0.5 mg - 1 mg/mL
técnica(s)
western blot: suitable
nº de adesão NCBI
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... CDKN2B(1030)
Imunogênio
Synthetic peptide directed towards the middle region of human CDKN2B
Aplicação
Anti-CDKN2B antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Ações bioquímicas/fisiológicas
CDKN2B has inhibitory effects on cell cycle progression. It binds to cyclin-dependent kinases and prevents their association with D-type cyclins. Methylation of CDKN2B has been associated with pathogenesis of pediatric myelodysplastic syndromes and in malignant hematopoiesis. Mutations in CDKN2B gene have been observed in malignant gliomas.
Sequência
Synthetic peptide located within the following region: REGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Ferramenta de seleção de produtos.
Código de classe de armazenamento
12 - Non Combustible Liquids
Classe de risco de água (WGK)
WGK 3
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Certificados de análise (COA)
Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Yanhong Liu et al.
Current opinion in genetics & development, 20(3), 239-244 (2010-03-10)
Recent advances in human genome studies have opened new avenues for the identification of susceptibility genes for many complex genetic disorders, especially in the field of rare cancers such as glioma. To date, eight glioma susceptibility loci have been identified
Utz Krug et al.
Oncogene, 21(21), 3475-3495 (2002-05-29)
Over the last decade, a growing number of tumor suppressor genes have been discovered to play a role in tumorigenesis. Mutations of p53 have been found in hematological malignant diseases, but the frequency of these alterations is much lower than
Miyoung Kim et al.
Acta haematologica, 130(2), 115-121 (2013-04-11)
Transcriptional repression of tumor suppressor genes is determined by the quantity of promoter hypermethylation. We analyzed the methylation quantity of CDKN2B in pediatric myelodysplastic syndromes (MDS). Quantitative measurement of CDKN2B methylation was performed in 25 pediatric MDS patients and 12
Moon-Taek Park et al.
Journal of biochemistry and molecular biology, 36(1), 60-65 (2003-01-25)
Cancer is frequently considered to be a disease of the cell cycle. As such, it is not surprising that the deregulation of the cell cycle is one of the most frequent alterations during tumor development. Cell cycle progression is a
Nerea Méndez-Barbero et al.
EBioMedicine, 46, 274-289 (2019-08-10)
Tumor necrosis factor-like weak inducer of apoptosis (Tnfsf12; TWEAK) and its receptor Fibroblast growth factor-inducible 14 (Tnfrsf12a; Fn14) participate in the inflammatory response associated with vascular remodeling. However, the functional effect of TWEAK on vascular smooth muscle cells (VSMCs) is
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica