AV02065

Anti-TNFRSF10A antibody produced in rabbit

IgG fraction of antiserum

• Sinônimo(s): Anti-Tumor necrosis factor receptor superfamily, member 10a
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: IgG fraction of antiserum
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 50 kDa
• reatividade de espécies: human
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NP_003835
• nº de adesão UniProt: O00220
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... TNFRSF10A(8797)

Descrição

Imunogênio

The immunogen for anti-TNFRSF10A antibody: synthetic peptide derected towards the C terminal of human TNFRSF10A

Aplicação

Anti-TNFRSF10A antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Ações bioquímicas/fisiológicas

TNFRSF10A or Death receptor 4 is a mediator of apoptosis and tumor suppression. Mutation in TNFRSF10A gene or dysfunction of the receptor results in tumor development and invasion. Polymorphism of Glu228Ala residue in TNFRSF10A is identified as a risk factor in metastatic prostate cancer after radiation therapy.

Sequência

Synthetic peptide located within the following region: RAGTAGPGDALYAMLMKWVNKTGRNASIHTLLDALERMEERHAKEKIQDL

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable