APREST94129

PrEST Antigen GJA1

Prestige Antigens Powered by Atlas Antibodies

• Sinônimo(s): CX43, GJAL, ODD, ODDD, ODOD, SDTY3
• Código UNSPSC: 12352203

Propriedades

• recombinante: expressed in E. coli
• Ensaio: >80% (SDS-PAGE)
• forma: buffered aqueous solution
• peso molecular: predicted mol wt 24 kDa
• purificado por: immobilized metal affinity chromatography (IMAC)
• concentração: ≥0.5 mg/mL
• sequência de imunogênio: GKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQAS
• Ensembl | Número de adesão de ser humano: ENSG00000152661
• nº de adesão UniProt: P17302
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• Informações sobre genes: human ... GJA1(2697)

Descrição

Descrição geral

Recombinant protein fragment of Human GJA1 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag

Aplicação

Blocking agent and positive assay control using corresponding antibodies.

forma física

Solution in phosphate-buffered saline and 1M Urea, pH 7.4

Nota de preparo

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 2
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable