APREST80543

PrEST Antigen ELMOD1

Prestige Antigens^™ Powered by Atlas Antibodies, buffered aqueous solution

• Sinônimo(s): DKFZp547C176
• Código UNSPSC: 12352202

Propriedades

• recombinante: expressed in E. coli
• Ensaio: >80% (SDS-PAGE)
• forma: buffered aqueous solution
• peso molecular: predicted mol wt 27 kDa
• purificado por: immobilized metal affinity chromatography (IMAC)
• concentração: ≥0.5 mg/mL
• sequência de imunogênio: THFYNIAPEAPTLSHFQQTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM
• Ensembl | Número de adesão de ser humano: ENSG00000110675
• nº de adesão UniProt: Q8N336
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• Informações sobre genes: human ... ELMOD1(643923)

Descrição

Descrição geral

Recombinant protein fragment of Human ELMOD1 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.

Aplicação

Suitable as a blocking agent using corresponding antibodies.

Ligação

Corresponding Antibody HPA038434.

forma física

Solution in 1 M urea-PBS, pH 7.4

Nota de preparo

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Informações legais

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 2
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable