WH0006623M1

Anti-γ-Synuclein (SNCG) Antibody

mouse monoclonal, 2C3

• Synonyme(s) : Anti-BCSG1, Anti-SR, Anti-synuclein, gamma (breast cancer-specific protein 1)
• Numéro MDL: MFCD02097426
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Nom du produit: Monoclonal Anti-SNCG antibody produced in mouse, clone 2C3, purified immunoglobulin, buffered aqueous solution
• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 2C3, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG2aκ
• Numéro d'accès GenBank: BC014098
• Numéro d'accès UniProt: O76070
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... SNCG(6623)

Description

Description générale

Synuclein gamma (SNCG) gene encodes a member of the synuclein family of proteins which are believed to be involved in the pathogenesis of neurodegenerative diseases. Mutations in this gene have also been associated with breast tumor development. (provided by RefSeq).
Synuclein gamma (SNCG) is a breast cancer specific gene. SNCG is highly expressed in malignant cancer cells and neuronal cells. SNCG gene is located on human chromosome 10q23.2. SNCG is a member of the brain protein synuclein family.

Immunogène

SNCG (AAH14098, 21 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD

Application

Monoclonal Anti-SNCG antibody produced in mouse has been used in western blotting.

Actions biochimiques/physiologiques

Synuclein gamma (SNCG) induces migration, invasion and metastasis of tumor cells. It promotes the migration of human breast adenocarcinoma cell line (MCF7) by activating extracellular-signal regulated kinase (Erk) pathway and disrupting cell-cell junctions. SNCG is associated with breast or ovarian cancer progression. Urine SNCG is used as a prognostic biomarker for bladder cancer.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)