Accéder au contenu
Merck
Toutes les photos(4)

Principaux documents

MSQC3

Sigma-Aldrich

SILuMAB Stable-Isotope Labeled Universal Monoclonal Antibody Standard human

recombinant, expressed in CHO cells

Synonyme(s) :

Mass spectrometry standard, IgG, Mass spectrometry standard, Immunoglobulin-G, Stable isotope labelled IgG

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
388,00 €

388,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Devis pour commande en gros

Sélectionner une taille de conditionnement

Changer de vue
100 μG
388,00 €

About This Item

Code UNSPSC :
23201100
Nomenclature NACRES :
NA.12

388,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Devis pour commande en gros

Produit recombinant

expressed in CHO cells

Niveau de qualité

Essai

≥90% (SDS-PAGE)

Conditionnement

vial of 100 μg (± 10% Lot-specific vial content given on certificate of analysis)

Conditions d'expédition

wet ice

Température de stockage

−20°C

Vous recherchez des produits similaires ? Visite Guide de comparaison des produits

Description générale

SILuMab is a recombinant, stable isotope-labeled, human monoclonal antibody which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in CHO cells, SILuMab is designed to be used as a universal internal standard for bioanalysis of monoclonal antibodies. Because of overlap with common sequences in the Fc region with candidate antibodies, SILuMab provides universal utility and thus eliminates the need to produce candidate-specific internal standards. SILuMab is an IgG1 antibody with lambda light chain, but contains peptide sequences common to other IgG isotypes.

Application

SILuMAB Stable-Isotope Labeled Universal Monoclonal Antibody Standard human has been used in a comparative study of automated antibody de novo sequencing.[1]

Caractéristiques et avantages

Universal Peptide SequenceLocation
DTLMISRHeavy Chain (IgG1, IgG2, IgG3, IgG4)
FNWYVDGVEVHNAKHeavy Chain (IgG1)
VVSVLTVLHQDWLNGKHeavy Chain (IgG1, IgG3, IgG4)
NQVSLTCLVKHeavy Chain (IgG1, IgG2, IgG3, IgG4)
GFYPSDIAVEWESNGQPENNYKHeavy Chain (IgG1, IgG4)
AGVETTTPSKLight Chain (lambda)
YAASSYLSLTPEQWKLight Chain (lambda)
SILuMab has been validated as an internal standard for quantitation of relevant biotherapeutics in a complex biological matrix by MRM-based LC-MS/MS.
  • SILuMab yielded reproducible, linear curves from 0.1 μg/mL to 1000 μg/mL without enrichment or depletion.
  • Good agreement was observed between multiple peptides derived from the same target.
  • Label incorporation was determined to be >98% by mass spectrometry.
  • Sequence coverage was confirmed by peptide mapping.

Forme physique

Supplied as a lyophilized powder containing phosphate buffered saline

Notes préparatoires

Produced utilizing enriched media containing stable isotope labeled amino acids are 13C6, 15N4-labeled arginine and 13C6, 15N2-labeled lysine
SILuMab design is optimized to be used as an internal standard for quantitation of monoclonal antibodies as well as Fc-fusion therapeutics. Because of overlap with the common sequences in the Fc region with candidate antibodies, SILuMab provides univer­sal utility, thus eliminating the need for production of candidate-specific internal standards.

Reconstitution

SILuMab recovery is maximized when 0.1% formic acid is used for reconstitution of the lyophilized product. Reconstitution with other solvents may reduce recovery. Do not freeze after reconstitution.
Procedure
  • Briefly centrifuge the vial at ~10,000 x g to collect the product at the bottom of the vial.
  • Add 500 μL of purified water containing 0.1% formic acid to the vial.
  • Mix the contents by gently inverting the vial a minimum of 5 times.
  • Allow the vial to stand at room temperature for a minimum of 15 minutes and repeat mixing by inversion.

Remarque sur l'analyse

SILuMab Heavy Chain
EVQLVESGGGLVQPGGSLRLSCVASGFTLNNYDMHWVRQGIGKGLEWVSKI
GTAGDRYYAGSVKGRFTISRENAKDSLYLQMNSLRVGDAAVYYCARGAGRW
APLGAFDIWGQGTMVTVSS|ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF
PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR
TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV
VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS
RDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SILuMab Light Chain
QSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNFVSWYQQHPGKAPKLMIY
DATKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGDYTPGV
VFGGGTKLTVL|GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTV
AWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQ
VTHEGSTVEKTVAPTECS

Target overlap areas are underlined
Qualitative
Intact heavy and light chains (FASTA file)

Quantitative
MRM settings provided (Skyline, xls)
Package size based on protein content determined by A280 using an extinction coefficient (E0.1%) of 1.4

Informations légales

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), [email protected].
SILu is a trademark of Sigma-Aldrich Co. LLC

Produit(s) apparenté(s)

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Qian Zhang et al.
Analytical chemistry, 86(17), 8776-8784 (2014-07-11)
Quantitation of therapeutic monoclonal antibodies (mAb) using liquid chromatography-tandem mass spectrometry (LC-MS/MS) for pharmacokinetic (PK) studies is becoming an essential complement to traditional antibody-based ligand binding assays (LBA). Here we show an automated method to perform LC-MS/MS-based quantitation, with IgG1
K Ilker Sen et al.
Journal of the American Society for Mass Spectrometry, 28(5), 803-810 (2017-01-21)
Applications of antibody de novo sequencing in the biopharmaceutical industry range from the discovery of new antibody drug candidates to identifying reagents for research and determining the primary structure of innovator products for biosimilar development. When murine, phage display, or
Automated Antibody De Novo Sequencing and Its Utility in Biopharmaceutical Discovery.
Sen K I, et al.
Journal of the American Society For Mass Spectrometry, 28(5), 803-810 (2017)
Noritaka Hashii et al.
Bioanalysis, 12(4), 231-243 (2020-02-25)
Aim: A generic bioanalytical method was developed to quantify therapeutic IgG1 monoclonal antibodies (mAbs) in mouse sera by combining an easy sample preparation method with LC/MS using selected reaction monitoring. Materials & methods: Rituximab and trastuzumab were used as model
Christina Boch et al.
Biomedicines, 10(9) (2022-09-24)
One important prerequisite for developing a therapeutic monoclonal antibody is to evaluate its in vivo efficacy. We tested the therapeutic potential of an anti-CD96 antibody alone or in combination with an anti-PD-1 antibody in a mouse colon cancer model. Early

Contenu apparenté

Découvrez notre grande variété de produits pour l'analyse de la masse intacte des anticorps monoclonaux, notamment des colonnes d'exclusion stérique (SEC), des colonnes à échange d'ions, des colonnes de phase inverse, des tampons de HPLC, des matrices et étalons MALDI, des solvants de haute pureté, des réactifs, des outils pour la préparation des échantillons de protéines et des matériaux de référence certifiés.

Discover our wide variety of products for intact mass analysis of monoclonal antibodies, including size-exclusion columns (SEC), ion exchange columns, reverse-phase columns, HPLC buffers, MALDI matrices and standards, high-purity solvents, reagents, tools for protein sample preparation, and certified reference materials.

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique