Accéder au contenu
Merck
Toutes les photos(8)

Principaux documents

HPA019136

Sigma-Aldrich

Anti-NUDCD3 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

Synonyme(s) :

Anti-NudC domain-containing protein 3

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
540,00 €

540,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.


Sélectionner une taille de conditionnement

Changer de vue
100 μL
540,00 €

About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

540,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

independent
Learn more about Antibody Enhanced Validation

Technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
western blot: 0.04-0.4 μg/mL

Séquence immunogène

RRKEEEEAKTVSAAAAEKEPVPVPVQEIEIDSTTELDGHQEVEKVQPPGPVKEMAHGSQEAEAPGAVAGAAE

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... NUDCD3(23386)

Description générale

The gene NUDCD3 (NudC domain-containing gene 3) is mapped to human chromosome 7p13-p12. The protein localizes to the centrosome and midbody.

Immunogène

NudC domain-containing protein 3 recombinant protein epitope signature tag (PrEST)

Application

Anti-NUDCD3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence[1] and western blotting.[1] To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Actions biochimiques/physiologiques

NUDCD3 (NudC domain-containing gene 3) is involved in cytokinesis by stabilization of dynein intermediate chain. Absence of NUDCD3 induces mitotic defects. Disturbances in NUDCD3 levels cause mislocalization of the dynein complex from kinetochores, spindle microtubules, and spindle poles, aggregation of dynein intermediate chain in the cytoplasm and degradation of dynein intermediate chain.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST74853

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Mariana Tamazato Longhi et al.
PloS one, 11(7), e0159856-e0159856 (2016-07-23)
Maspin (SerpinB5) is a non-inhibitory serpin (serine protease inhibitor) with very diverse biological activities including regulation of cell adhesion, migration, death, control of gene expression and oxidative stress response. Initially described as a tumor and metastasis suppressor, clinical data brought
Koji Okabayashi et al.
Cancer science, 103(9), 1617-1624 (2012-06-09)
Esophageal squamous cell cancer (ESCC) is one of the most common lethal tumors in the world, and development of new diagnostic and therapeutic methods is needed. In this study, cancer-testis antigen, BORIS, was isolated by functional cDNA expression cloning using
Inhibition of cytokinesis by overexpression of NudCL that is localized to the centrosome and midbody.
Yuqi Cai et al.
Cell research, 19(11), 1305-1308 (2009-10-07)
Tianhua Zhou et al.
Proceedings of the National Academy of Sciences of the United States of America, 103(24), 9039-9044 (2006-06-07)
Cytoplasmic dynein, a minus-end-directed microtubule motor, has been implicated in many fundamental cellular processes; however, little is known regarding the underlying molecular machinery that regulates its stability. In Aspergillus nidulans, nuclear distribution gene C (nudC) has been implicated in the
David Asante et al.
Journal of cell science, 127(Pt 21), 4774-4787 (2014-09-11)
Cytoplasmic dynein-2 is the motor for retrograde intraflagellar transport (IFT), and mutations in dynein-2 are known to cause skeletal ciliopathies. Here, we define for the first time the composition of the human cytoplasmic dynein-2 complex. We show that the proteins

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique