Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

AV50093

Sigma-Aldrich

Anti-PIGO antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-DKFZp434M222, Anti-FLJ00135, Anti-MGC20536, Anti-MGC3079, Anti-Phosphatidylinositol glycan anchor biosynthesis, class O, Anti-RP11-182N22.4

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

74 kDa

Espèces réactives

guinea pig, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_116023

Numéro d'accès UniProt

Q8TEQ8

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PIGO(84720)

Description générale

The previously assigned protein identifier B1AML3 has been merged into Q8TEQ8. Full details can be found on the UniProt database.

Immunogène

Synthetic peptide directed towards the N terminal region of human PIGO

Application

Anti-PIGO antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Actions biochimiques/physiologiques

Phosphatidylinositol glycan anchor biosynthesis, class O (PIGO; HPMRS2) protein is involved in the biosynthesis of glycosylphosphatidylinositol anchor that is present on blood cells and anchors the cell surface proteins. Mutations in PIGO gene results in hyperphosphatasia with mental retardation (HPMRS).

Séquence

Synthetic peptide located within the following region: LIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARLYRS

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

12 - Non Combustible Liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

T Kinoshita et al.
Current opinion in chemical biology, 4(6), 632-638 (2000-12-05)
The pathway for glycosylphosphatidylinositol-anchor biosynthesis consists of at least 10 reaction steps. Many of the genes encoding the enzymes and regulators involved in this pathway have been recently cloned and their products characterised. These studies have revealed the common and
Peter M Krawitz et al.
American journal of human genetics, 91(1), 146-151 (2012-06-12)
Hyperphosphatasia with mental retardation syndrome (HPMRS), an autosomal-recessive form of intellectual disability characterized by facial dysmorphism, seizures, brachytelephalangy, and persistent elevated serum alkaline phosphatase (hyperphosphatasia), was recently shown to be caused by mutations in PIGV, a member of the glycosylphosphatidylinositol

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique