WH0083700M1

Monoclonal Anti-JAM3 antibody produced in mouse

clone 1D3, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-FLJ14529, Anti-JAMC, Anti-junctional adhesion molecule 3
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 1D3, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable
• Isotyp: IgG2aκ
• GenBank-Hinterlegungsnummer: NM_032801
• UniProt-Hinterlegungsnummer: Q9BX67
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... JAM3(83700)

Beschreibung

Allgemeine Beschreibung

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is localized in the tight junctions between high endothelial cells. Unlike other proteins in this family, the this protein is unable to adhere to leukocyte cell lines and only forms weak homotypic interactions. The encoded protein is a member of the junctional adhesion molecule protein family and acts as a receptor for another member of this family. (provided by RefSeq)

Immunogen

JAM3 (NP_116190, 82 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELT*

Leistungsmerkmale und Vorteile

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: nwg
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)