WH0010403M1

Monoclonal Anti-KNTC2 antibody produced in mouse

clone 1A10, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-HEC, Anti-HEC1, Anti-kinetochore associated 2
• UNSPSC Code: 12352203
• NACRES: NA.41
• MDL number: MFCD02263005
• Conjugate: unconjugated
• Clone: 1A10, monoclonal
• Application: ELISA (i), WB
• Citations: -

Eigenschaften

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1A10, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable, western blot: 1-5 μg/mL
• isotype: IgG1κ
• GenBank accession no.: BC035617
• UniProt accession no.: O14777
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... NDC80(10403)

Beschreibung

General description

HEC is one of several proteins involved in spindle checkpoint signaling. This surveillance mechanism assures correct segregation of chromosomes during cell division by detecting unaligned chromosomes and causing prometaphase arrest until the proper bipolar attachment of chromosomes is achieved.[supplied by OMIM

Immunogen

KNTC2 (AAH35617, 545 a.a. ~ 642 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Sicherheitshinweise

• Lagerklasse: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• PSA (Persönliche Schutzausrüstung): Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)