WH0006654M1

Monoclonal Anti-SOS1 antibody produced in mouse

clone 4C1, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-GF1, Anti-GGF1, Anti-GINGF, Anti-HGF, Anti-son of sevenless homolog 1 (Drosophila)
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 4C1, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable; proximity ligation assay: suitable
• Isotyp: IgG2aκ
• GenBank-Hinterlegungsnummer: NM_005633
• UniProt-Hinterlegungsnummer: Q07889
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SOS1(6654)

Beschreibung

Allgemeine Beschreibung

This gene encodes a protein that is a guanine nucleotide exchange factor for RAS proteins, membrane proteins that bind guanine nucleotides and participate in signal transduction pathways. GTP binding activates and GTP hydrolysis inactivates RAS proteins. The product of this gene may regulate RAS proteins by facilitating the exchange of GTP for GDP. Mutations in this gene are associated with gingival fibromatosis 1 and Noonan syndrome type 4. (provided by RefSeq)

Immunogen

SOS1 (NP_005624, 313 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)