Direkt zum Inhalt
Merck

WH0002119M2

Sigma-Aldrich

Monoclonal Anti-ETV5 antibody produced in mouse

clone 7C10, purified immunoglobulin, buffered aqueous solution

Synonym(e):

Anti-ERM, Anti-ets variant gene 5 (ets-related molecule)

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise

Größe auswählen

100 μG
€ 418,00

€ 418,00


Versand innerhalb von 2 Wochen. (Bei Bestellungen außerhalb der USA und Europas rechnen Sie bitte zusätzlich 1–2 Wochen für die Lieferung ein.)


Größe auswählen

Ansicht ändern
100 μG
€ 418,00

About This Item

UNSPSC-Code:
12352203
NACRES:
NA.41

€ 418,00


Versand innerhalb von 2 Wochen. (Bei Bestellungen außerhalb der USA und Europas rechnen Sie bitte zusätzlich 1–2 Wochen für die Lieferung ein.)

Biologische Quelle

mouse

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

purified immunoglobulin

Antikörper-Produkttyp

primary antibodies

Klon

7C10, monoclonal

Form

buffered aqueous solution

Speziesreaktivität

human, mouse, rat

Methode(n)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotyp

IgG1κ

GenBank-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

Versandbedingung

dry ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... ETV5(2119)

Allgemeine Beschreibung

E-twenty-six (Ets) variant gene 5 (ETV5) protein belongs to the polyoma enhancer activator 3 (PEA3) subfamily of ETS transcription factors. The ETV5 gene is located on the human chromosome at 3q27.2.

Immunogen

ETV5 (NP_004445, 181 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPM

Anwendung

Monoclonal Anti-ETV5 antibody produced in mouse has been used in western blotting[1] (1:1000)[2][3].

Biochem./physiol. Wirkung

E-twenty-six (Ets) variant gene 5 (ETV5) gene is responsible for the survival, proliferation, and self-renewal of spermatogonial stem cells (SSCs). ETV5 protein plays a role in mediating glial cell line-derived neurotrophic factor (GDNF) signaling and induces several genes required for regulating SSC fate. It is involved in limb development and regulates epithelial-mesenchymal transition in several cancer cells. ETV5 protein binds to the conserved GGAA/T motif and regulates gene expression.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable

Persönliche Schutzausrüstung

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Lee Huang et al.
Cancer research, 81(8), 2071-2085 (2021-02-03)
The failure of once promising target-specific therapeutic strategies often arises from redundancies in gene expression pathways. Even with new melanoma treatments, many patients are not responsive or develop resistance, leading to disease progression in terms of growth and metastasis. We
Xin Wu et al.
Biology of reproduction, 85(6), 1114-1123 (2011-08-06)
Insight regarding mechanisms controlling gene expression in the spermatogonial stem cell (SSC) will improve our understanding of the processes regulating spermatogenesis and aid in treating problems associated with male infertility. In the present study, we explored the global gene expression
Erik Melén et al.
The Journal of allergy and clinical immunology, 126(3), 631-637 (2010-09-08)
Epidemiologic studies consistently show associations between asthma and obesity. Shared genetics might account for this association. We sought to identify genetic variants associated with both asthma and obesity. On the basis of a literature search, we identified genes from (1)
Duy Pham et al.
The Journal of allergy and clinical immunology, 134(1), 204-214 (2014-02-04)
The differentiation of TH17 cells, which promote pulmonary inflammation, requires the cooperation of a network of transcription factors. We sought to define the role of Etv5, an Ets-family transcription factor, in TH17 cell development and function. TH17 development was examined
Severa Bunda et al.
Nature communications, 10(1), 661-661 (2019-02-10)
Capicua (CIC) is a transcriptional repressor that counteracts activation of genes downstream of receptor tyrosine kinase (RTK)/Ras/ERK signaling. It is well-established that tumorigenesis, especially in glioblastoma (GBM), is attributed to hyperactive RTK/Ras/ERK signaling. While CIC is mutated in other tumors

Questions

Reviews

No rating value

Active Filters

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.