SAB1413292

Monoclonal Anti-CLDN6 antibody produced in mouse

clone 1P8, purified immunoglobulin, buffered aqueous solution

• Synonym(e): CLDN6
• UNSPSC-Code: 51111800

Eigenschaften

• Konjugat: unconjugated
• Qualitätsniveau: 100
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 1P8, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: 23.3 kDa
• Speziesreaktivität: human
• Konzentration: ~0.3-1 μg/μL (Please refer to lot specific concentration)
• Methode(n): ELISA: suitable
• Isotyp: IgG2b, kappa
• Protein-ID-Hinterlegungsnummer: NM_021195.3
• Versandbedingung: dry ice
• Lagertemp.: -10 to -25°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... CLDN6(9074)

Beschreibung

Allgemeine Beschreibung

Mouse monoclonal antibody raised against a full-length recombinant CLDN6.

Immunogen

CLDN6 (NP_067018.1, 1 a.a. ~ 220 a.a) full-length recombinant protein with GST tag.

Sequenz

MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAVIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Angaben zur Herstellung

Purification by Protein A sepharose

Lagerung und Haltbarkeit

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 2
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable