SAB1407100

Anti-DUSP14 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Synonym(e): MKP-L, MKP6
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen ~22.3 kDa
• Speziesreaktivität: human
• Methode(n): indirect immunofluorescence: suitable; western blot: 1 μg/mL
• NCBI-Hinterlegungsnummer: NM_007026.1
• UniProt-Hinterlegungsnummer: O95147
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... DUSP14(11072)

Beschreibung

Allgemeine Beschreibung

In addition to antigen recognition by the T-cell receptor, T-cell activation requires a second signal from a costimulatory receptor, such as CD28 (MIM 186760), which interacts with B7-1 (CD80; MIM 112203) and B7-2 (CD86; MIM 601020) ligands on antigen-presenting cells. CD28 costimulation induces transcription of interleukin-2 (IL2; MIM 147680) and stabilizes newly synthesized IL2 through the activation of mitogen-activated protein kinases (MAPKs), such as ERK (e.g., MAP2K4; MIM 601335) and JNK (see MIM 601158), and the subsequent creation of AP1 transcription factor (see MIM 165160). DUSP14 is a negative regulator of CD28 signaling.[supplied by OMIM

Immunogen

DUSP14 (NP_008957.1, 1 a.a. ~ 198 a.a) full-length human protein.

Sequence
MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI

Anwendung

Anti-DUSP14 antibody produced in mouse is suitable for indirect immunofluorescence and western blot assay.

Biochem./physiol. Wirkung

DUSP14 (Dual specificity phosphatase 14) is associated with several critical signaling pathways. It has ability to dephosphorylate both phosphotyrosine and phosphoserine/phosphothreonine residues on substrates. DUSP14 controls MAPK (mitogen-activated protein kinase) signaling pathway by dephosphorylating MAPK proteins ERK (extracellular-signal-regulated kinase), JNK (c-Jun N-terminal kinase) and p38. It has been reported that DUSP14 participates in T cell proliferation as a negative-feedback regulator.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable