SAB1403984

Monoclonal Anti-INSRR antibody produced in mouse

clone 5C6, purified immunoglobulin, buffered aqueous solution

• Synonym(e): IRR
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 5C6, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen ~38.1 kDa
• Speziesreaktivität: human, rat
• Methode(n): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG1κ
• NCBI-Hinterlegungsnummer: NM_014215
• UniProt-Hinterlegungsnummer: P14616
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... INSRR(3645)

Beschreibung

Allgemeine Beschreibung

Mouse monoclonal antibody raised against a partial recombinant INSRR.
The gene INSRR (insulin receptor related receptor) is mapped to human chromosome 1q21-q23. It belongs to the insulin receptor family of proteins. INSRR is mainly present in organs which are associated with acid/base generation. The protein has two N-terminal leucine-rich repeat domains, a cysteine-rich C domain and three C-terminal fibronectin type-III repeats.

Immunogen

INSRR (NP_055030, 651 a.a. ~ 760 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LYLNDYCHRGLRLPTSNNDPRFDGEDGDPEAEMESDCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNAITIPISPWKVTSINKSPQRDSGRHRRAAGPLRLGGNSSDF

Biochem./physiol. Wirkung

INSRR (insulin receptor related receptor) exhibits pH-sensing property and is a sensor for mild alkaline extracellular medium. In mice, it is associated with excessive excretion of base by the kidneys.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable