SAB1403276

Monoclonal Anti-DPP8 antibody produced in mouse

clone 1B10, purified immunoglobulin, buffered aqueous solution

• Synonym(e): DP8, DPRP1, FLJ14920, FLJ20283, MGC26191, MSTP141
• UNSPSC-Code: 12352203
• NACRES: NA.43

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 1B10, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen ~35.35 kDa
• Speziesreaktivität: human
• Methode(n): capture ELISA: suitable; indirect ELISA: suitable
• Isotyp: IgG2aκ
• NCBI-Hinterlegungsnummer: NM_197961
• UniProt-Hinterlegungsnummer: Q6V1X1
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... DPP8(54878)

Beschreibung

Allgemeine Beschreibung

This gene encodes a member of the peptidase S9B family, a small family of dipeptidyl peptidases that are able to cleave peptide substrates at a prolyl bond. The encoded protein shares similarity with dipeptidyl peptidase IV in that it is ubiquitously expressed, and hydrolyzes the same substrates. These similarities suggest that, like dipeptidyl peptidase IV, this protein may play a role in T-cell activation and immune function. Alternatively spliced transcript variants encoding different isoforms have been described. (provided by RefSeq)

Immunogen

DPP8 (NP_932065.1, 161 a.a. ~ 244 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
IGTVGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQPLRPNLVETSCPNIRMDPKLCPADPDWIAFIHSNDIWISNIVTR

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable