SAB1402859

Monoclonal Anti-NOS2 antibody produced in mouse

clone 2G4, purified immunoglobulin, buffered aqueous solution

• Synonym(e): HEP-NOS, INOS, NOS, NOS2A
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 2G4, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen ~38.21 kDa
• Speziesreaktivität: human
• Methode(n): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG1κ
• NCBI-Hinterlegungsnummer: NM_000625
• UniProt-Hinterlegungsnummer: P35228
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... NOS2(4843)

Beschreibung

Allgemeine Beschreibung

Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. This gene encodes a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17. (provided by RefSeq)

Immunogen

NOS2 (NP_000616, 685 a.a. ~ 794 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDLSKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQPALVQGILERVVDG

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable