MSQC29

SILu^®MAb Vedolizumab Stable-Isotope Labeled Monoclonal Antibody

recombinant, expressed in CHO cells

• Synonym(e): Full Length SIL Protein Internal Standard, SIL Biologic Antibody Mimic, SIL Biotherapeutic Antibody Mimic, Stable Isotope Labeled (SIL) Antibody
• NACRES: NA.24
• UNSPSC Code: 12352203
• Clone: -
• Species reactivity: -
• Application: —
• Citations: -

Eigenschaften

• recombinant: expressed in CHO cells
• Quality Segment: 200
• assay: ≥90% (HPLC)
• form: solid
• suitability: suitable for mass spectrometry
• shipped in: wet ice
• storage temp.: −20°C

Beschreibung

General description

SILu^™MAb Vedolizumab (MSQC29) is a recombinant, stable isotope-labeled, monoclonal antibody which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in CHO cells, it is designed to be used as an internal standard for the quantitative mass spectrometry analysis of Vedolizumab in human and animal serum.

SILu^™MAb Vedolizumab is for research use only and is not intended for diagnostic or therapeutic use.

Analysis Note

Quantitative
MRM settings provided (xls)

Other Notes

SILu^™MAb Vedolizumab Heavy Chain:
QVQLVQSGAEVKKPGASVKVSCKGSGYTFTSYWMHWVRQAPGQRLEWIGEIDPSESNTNYNQKFKGRVTLTVDISASTAYMELSSLRSEDTAVYYCARGGYDGWDYAIDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELAGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SILu^™MAb Vedolizumab Light Chain:
DVVMTQSPLSLPVTPGEPASISCRSSQSLAKSYGNTYLSWYLQKPGQSPQLLIYGISNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQGTHQPYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Legal Information

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

SILu is a trademark of Sigma-Aldrich Co. LLC

Silver Shield is a registered trademark of Siebe North, Inc.

Sicherheitshinweise

• Lagerklasse: 13 - Non Combustible Solids
• wgk: WGK 3