HPA055888

Anti-FAM107A antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-DRR1, Anti-TU3A, Anti-family with sequence similarity 107, member A
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA055888
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Methode(n): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• Immunogene Sequenz: NQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEER
• UniProt-Hinterlegungsnummer: O95990
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... FAM107A(11170)

Beschreibung

Allgemeine Beschreibung

FAM107A (family with sequence similarity 107 member A) is expressed at high level in the brain and heart. It is also known as DRR1, FLJ30158, FLJ45473, TU3A. FAM107A has a nuclear localization signal (NLS) and a coiled domain. FAM107A has 144 amino acids and is located on human chromosome 3p14.3.

Immunogen

family with sequence similarity 107, member A recombinant protein epitope signature tag (PrEST)

Biochem./physiol. Wirkung

FAM107A (family with sequence similarity 107 member A) participates in neuronal cell survival. Overexpression of FAM107A has the ability to repress the development of tumor cells. It plays a major role in the progression of embryo. FAM107A participates in cell invasion. This protein modulates FA dynamics and cell movement.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST73998

Physikalische Form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable