Direkt zum Inhalt
Merck

HPA042001

Sigma-Aldrich

Anti-C19orf66 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-Chromosome 19 open reading frame 66, Anti-Flj11286

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise

Größe auswählen

100 μL
€ 544,00

€ 544,00


Versand in der Regel in 1 Woche. (Bei Bestellungen außerhalb der USA und Europas rechnen Sie bitte zusätzlich 1-2 Wochen für die Lieferung ein)


Größe auswählen

Ansicht ändern
100 μL
€ 544,00

About This Item

UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.41

€ 544,00


Versand in der Regel in 1 Woche. (Bei Bestellungen außerhalb der USA und Europas rechnen Sie bitte zusätzlich 1-2 Wochen für die Lieferung ein)

Biologische Quelle

rabbit

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Erweiterte Validierung

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Methode(n)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

Immunogene Sequenz

KFHGKASSKKAGALMRKFGSDHTGVGRSIVYGVKQKDGQELSNDLDAQDPPEDMKQDRDIQAVATSLLPLTEANLRMFQRAQDD

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

Allgemeine Beschreibung

C19ORF66, also known as repressor of yield of dengue virus (RyDEN) , is mapped to human chromosome 19p13.2. The gene consists of eight exons spanning ~7.1kb of genomic DNA. C19ORF66 is a 291 amino acid protein, comprising eight Α-helices and seven Β-strands.

Immunogen

chromosome 19 open reading frame 66 recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-C19orf66 antibody produced in rabbit has been used in fluorescent labelling.

Biochem./physiol. Wirkung

C19ORF66 functions as an interferon-stimulated gene (ISG) and hinders replication of various viruses including human immunodeficiency virus-1(HIV-1), hepatitis C virus, kunjin virus, chikungunya virus, and herpes simplex virus type 1.Increased expression of C19ORF66 is observed in human psoriatic skin compared to normal tissue.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST82714

Physikalische Form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Upregulation of ANGPTL6 in mouse keratinocytes enhances susceptibility to psoriasis.
Tanigawa H
Scientific Reports null
IRAV (FLJ11286), an Interferon-Stimulated Gene with Antiviral Activity against Dengue Virus, Interacts with MOV10.
Balinsky CA
Journal of Virology null
Characterization of RyDEN (C19orf66) as an Interferon-Stimulated Cellular Inhibitor against Dengue Virus Replication.
Suzuki Y.
PLoS Pathogens null
Corey A Balinsky et al.
Journal of virology, 91(5) (2016-12-16)
Dengue virus (DENV) is a member of the genus

Questions

Reviews

No rating value

Active Filters

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.