AV50952

Anti-HCG_1646157 (AB2) antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-LOC440122
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 63 kDa
• Speziesreaktivität: human
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: XP_001129759
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... ZNF891(101060200)

Beschreibung

Immunogen

Synthetic peptide directed towards the middle region of human hCG_1646157

Biochem./physiol. Wirkung

The amino acid sequence of hCG_1646157 is derived from an annotated genomic sequence (NT_024477) using gene prediction method: GNOMON, supported by mRNA and EST evidence. The exact function of hCG_1646157 remains unknown.

Sequenz

Synthetic peptide located within the following region: PVPNNLHMAQNACECNKDETLCHQSSLKKQGQTHTEKKHECNQCGKAFKR

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 12 - Non Combustible Liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable