AV49811
Anti-LENG4 antibody produced in rabbit
IgG fraction of antiserum
Synonym(e):
Anti-BB1
Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise
Alle Fotos(1)
About This Item
UNSPSC-Code:
12352203
NACRES:
NA.41
Empfohlene Produkte
Biologische Quelle
rabbit
Qualitätsniveau
Konjugat
unconjugated
Antikörperform
IgG fraction of antiserum
Antikörper-Produkttyp
primary antibodies
Klon
polyclonal
Form
buffered aqueous solution
Mol-Gew.
53 kDa
Speziesreaktivität
horse, dog, human, pig
Konzentration
0.5 mg - 1 mg/mL
Methode(n)
western blot: suitable
NCBI-Hinterlegungsnummer
UniProt-Hinterlegungsnummer
Versandbedingung
wet ice
Lagertemp.
−20°C
Posttranslationale Modifikation Target
unmodified
Angaben zum Gen
human ... LENG4(79143)
Verwandte Kategorien
Allgemeine Beschreibung
Membrane bound O-acyltransferase domain containing 7 (MBOAT7; LENG4; LPLAT7) belongs to membrane-bound O-acyltransferase (MBOAT) family. The protein shows an endoplasmic reticulum-like reticular pattern and perinuclear staining in HEK293 cells.
Immunogen
Synthetic peptide directed towards the C terminal region of human LENG4
Anwendung
Anti-LENG4 antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml. The antibody has been used for western blotting for proteins isolated from mice brain tissue.
Biochem./physiol. Wirkung
Membrane bound O-acyltransferase domain containing 7 (MBOAT7; LENG4) is an integral membrane protein important for reacylation of phospholipids. The reacylation is an important step in the recycling of phospholipids via the Land cycle. LENG4 is highly specific for arachidonoyl-coenzyme A and is involved in arachidonate recycling. LENG4 interacts with the small subunit of serine palmitoyltransferase a (ssSPTa). This interaction is important for LENG4-dependent incorporation of arachidonic acid into phosphatidylinositol.
Sequenz
Synthetic peptide located within the following region: LSAYWHGLHPGYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHW
Physikalische Form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Haftungsausschluss
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Produkt-Auswahlhilfe.
Lagerklassenschlüssel
10 - Combustible liquids
WGK
WGK 3
Flammpunkt (°F)
Not applicable
Flammpunkt (°C)
Not applicable
Analysenzertifikate (COA)
Suchen Sie nach Analysenzertifikate (COA), indem Sie die Lot-/Chargennummer des Produkts eingeben. Lot- und Chargennummern sind auf dem Produktetikett hinter den Wörtern ‘Lot’ oder ‘Batch’ (Lot oder Charge) zu finden.
Besitzen Sie dieses Produkt bereits?
In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.
Miriam Longo et al.
Cellular and molecular gastroenterology and hepatology, 13(3), 759-788 (2021-11-26)
The I148M Patatin-like Phospholipase Domain-containing 3 (PNPLA3), the rs641738 in the Membrane bound O-acyltransferase domain containing 7-transmembrane channel-like 4 (MBOAT7-TMC4) locus, and the E167K Transmembrane 6 Superfamily Member 2 (TM6SF2) polymorphisms represent the main predisposing factors to nonalcoholic fatty liver disease
Karen E Anderson et al.
PloS one, 8(3), e58425-e58425 (2013-03-09)
We disrupted the gene encoding lysophosphatidylinositol-acyltransferase-1 (LPIAT1) in the mouse with the aim of understanding its role in determining cellular phosphoinositide content. LPIAT1(-/-) mice were born at lower than Mendelian ratios and exhibited a severe developmental brain defect. We compared
Miguel A Gijón et al.
The Journal of biological chemistry, 283(44), 30235-30245 (2008-09-06)
The cycle of deacylation and reacylation of phospholipids plays a critical role in regulating availability of arachidonic acid for eicosanoid production. The major yeast lysophospholipid acyltransferase, Ale1p, is related to mammalian membrane-bound O-acyltransferase (MBOAT) proteins. We expressed four human MBOATs
Yusuke Hirata et al.
Genes to cells : devoted to molecular & cellular mechanisms, 18(5), 397-409 (2013-03-21)
Lysophosphatidylinositol acyltransferase 1 (LPIAT1), also known as MBOAT7, is a phospholipid acyltransferase that selectively incorporates arachidonic acid (AA) into the sn-2 position of phosphatidylinositol (PI). We previously demonstrated that LPIAT1 regulates AA content in PI and plays a crucial role
Hideo Shindou et al.
Journal of lipid research, 50 Suppl, S46-S51 (2008-10-22)
Cells of all organisms are enclosed by a plasma membrane containing bipolar lipids, cholesterol, and proteins. Cellular membranes contain several classes of glycerophospholipids, which have numerous structural and functional roles in cells. Polyunsaturated fatty acids including arachidonic acid and eicosapentaenoic
Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..
Setzen Sie sich mit dem technischen Dienst in Verbindung.