AV49670

Anti-SLC22A23 antibody produced in rabbit

IgG fraction of antiserum

• Synonym(e): Anti-DKFZP434F011, Anti-FLJ22174, Anti-SLC22A23, Anti-Solute carrier family 22, member 23
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 2

Eigenschaften

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 45 kDa
• species reactivity: pig, horse, rabbit, mouse, human, rat, dog
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_056297
• UniProt accession no.: A1A5C7-2
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SLC22A23(63027)

Beschreibung

Immunogen

Synthetic peptide directed towards the middle region of human SLC22A23

Application

Anti-SLC22A23 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

SLC22A23 (C6ORF85) is a member of transmembrane proteins that mediate the transport of organic ions across the cell membrane by acting as uniporters, symporters and antiporters. Single nucleotide polymorphisms in SLC22A23 gene are reportedly associated with ulcerative colitis.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: VVLCVNSLTGYGIHHCFARSMMGHEVKVPLLENFYADYYTTASIALVSCL

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklasse: 10 - Combustible liquids
• Was ist los?: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable