Synthetic peptide directed towards the N terminal region of human HTR1F
Anwendung
Anti-HTR1F antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 μg/ml.
Biochem./physiol. Wirkung
HTR1F is a post-synaptic 5-hydroxytryptamine (5-HT) receptor important in serotonergic functions. It negatively regulates 5-HT neuronal activity and has been implicated in mood regulation and responses to stress and emotions.
Sequenz
Synthetic peptide located within the following region: MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIV
Physikalische Form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Haftungsausschluss
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Neuropsychiatric disease and treatment, 9, 1699-1716 (2013-11-16)
Serotonin is a widely investigated neurotransmitter in several psychopathologies, including suicidal behavior (SB); however, its role extends to several physiological functions involving the nervous system, as well as the gastrointestinal and cardiovascular systems. This review summarizes recent research into ten
Questions
Reviews
★★★★★ No rating value
Active Filters
Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..
