AV100722

Anti-DMRT1 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-DMT1, Anti-Doublesex and mab-3 related transcription factor 1
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 2

Eigenschaften

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 39 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_068770
• UniProt accession no.: Q9Y5R6
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Quality Level: 100
• Gene Information: human ... DMRT1(1761)

Beschreibung

Immunogen

Synthetic peptide directed towards the N terminal region of human DMRT1

Application

Anti-DMRT1 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Biochem/physiol Actions

DMRT1 protein is involved in sex determination, pluripotency and meiosis. Depletion of both DMRT1 and p53 in spermatogonial stem cells induces pluripotency by upregulation of Sox2. Deficiency of DMRT1 results in apoptosis of germline stem cells.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: PNDEAFSKPSTPSEAPHAPGVPPQGRAGGFGKASGALVGAASGSSAGGSS

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklasse: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable