AV00022

Anti-CFLAR antibody produced in rabbit

IgG fraction of antiserum

• Synonym(e): Anti-CASP8 and FADD-like apoptosis Regulator
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: -

Eigenschaften

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 55 kDa
• species reactivity: human, bovine
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_003870
• UniProt accession no.: O15519
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CFLAR(8837)

Beschreibung

General description

CFLAR is a regulator of apoptosis that is thought to be cleaved by caspase-8. Rabbit Anti-CFLAR antibody recognizes canine, human, mouse, rat, bovine, and pig CFLAR.

Immunogen

Synthetic peptide directed towards the N terminal region of human CFLAR

Application

Rabbit Anti-CFLAR antibody can be used for western blot assays at 1.25μg/ml.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: HQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLA

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklasse: 10 - Combustible liquids
• Was ist los?: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable